Name: EGF - 650mcg
Brand: Peptide Revolution
SKU: 8901
Price: 254.15 EUR
Availability: InStock
Rating: 5 (1 reviews)

Find out what benefits peptides have

Discover how peptides can boost recovery, improve skin health, increase energy and support overall performance. Explained simply and clearly in this short video.

Product Description

Research Growth Factor Powder

EGF – 650 mcg

Research-grade

lyophilized protein powder

supplied in a sterile glass vial. EGF corresponds to

human epidermal growth factor

and is provided as a single-component research formulation containing

650 mcg EGF per vial
.

EGF is explored in controlled experimental settings for its relevance to

EGFR activation, intracellular signal transduction, cellular proliferation, migration, differentiation and receptor-trafficking research
.

Research Use Only

This product is intended strictly for laboratory and scientific investigation. Not for human consumption, therapeutic use or veterinary application.

Specifications

Compound

Human Epidermal Growth Factor (EGF)

Purity

Batch-specific; refer to the Certificate of Analysis (CoA)

Form

Lyophilized protein powder

Content

650 mcg EGF per vial

Packaging

Glass vial with sterile closure

Storage

Store lyophilized at −20 °C, desiccated and protected from light; follow the batch-specific CoA

Molecular Formula

C₂₇₀H₄₀₁N₇₃O₈₃S₇

Molecular Weight

≈ 6222 g·mol⁻¹ (6.22 kDa)

Protein Length

53-amino-acid mature human EGF

Structure

Single-chain growth factor containing three intramolecular disulfide bonds

Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

CAS Number

62253-63-8

Solubility

Product-specific; use a suitable sterile aqueous research buffer according to the CoA and validated protocol

Appearance

White to off-white lyophilized powder

Laboratory Preparation

Bacteriostatic Water 10 ml

Lyophilized EGF should be prepared using a sterile aqueous research buffer selected for the validated laboratory assay. Recombinant protein formulations may differ, so the product-specific Certificate of Analysis should be used to determine the appropriate solvent, pH, concentration and handling conditions.

Bacteriostatic water should only be used where compatibility is explicitly confirmed by the supplied product documentation and laboratory protocol.

Available research solvent:

Bacteriostatic Water – 10 ml
.

Research Overview

Epidermal growth factor is a

single-chain growth factor

studied primarily as a ligand of the epidermal growth factor receptor (EGFR). Ligand binding is investigated in experimental systems involving receptor dimerization, tyrosine-kinase activation and downstream intracellular signaling.
EGF-related research models are used to examine

cellular proliferation, migration, differentiation, survival signaling and receptor trafficking
.
No therapeutic or clinical claims are made or implied.

Primary Research Areas

EGFR Activation & Signal Transduction

Used in laboratory models examining ligand–receptor binding, receptor dimerization, phosphorylation and downstream signaling pathways associated with EGFR activation.

Cellular Proliferation

Investigated in controlled cell-culture systems studying growth-factor-dependent cell-cycle activity, DNA-synthesis responses and changes in cellular proliferation.

Cell Migration & Motility

Applied in experimental assays examining cell movement, migration-associated signaling and in vitro wound-closure behavior under defined laboratory conditions.

Cellular Differentiation

Used to investigate changes in cellular morphology, phenotype and function following EGFR-pathway stimulation in epithelial and other experimental cell models.

Receptor Internalization & Trafficking

Relevant to studies of ligand-induced EGFR internalization, endosomal transport, receptor recycling and signal attenuation in controlled cellular systems.

Laboratory handling note:

Lyophilized recombinant proteins should be handled using suitable sterile research buffers and stored under the light-protected, desiccated conditions specified in the batch Certificate of Analysis.